Lactococcus lactis IL1403 sequencing project 
PressOko
INRA
French
Anglais
PCRmap
MolOko
ProtOko
PeptOko
Credits
Blast
AnnOko
PatScan
Links
ILnet
Genoscope
Attention!
You are working with RL000801 version of L.lactis IL1403 genome annotation. Internal gene identificator L152977, gene name and functional assigment can be subject to change.
Please send comments to moloko@spock.jouy.inra.fr
>L152977 IL1403gene=yrgI (1770 kb forward) PMG2_ECOLI HYPOTHETICAL PROTEIN EVIDENCE BY HOMOLOGY BIO15.01 HYPOTHETICAL
 
 MTEVYFIRHSLRDNAAYDDMDVPLTAEGEKRALILADAFANVSIEQIFSSPFQ
 RSVRTLNPLAHSKNLEIQLISDFRERNVGHEIADFWPFAKQQWNDFDYKFADGESLREVQ
 NRNISALEQILTTSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFA
 ENKYLTHQVIEIDYEQ*